PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A03G0632
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 525aa    MW: 57148.3 Da    PI: 6.8593
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A03G0632genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.66.4e-42176251277
                  -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  Cqv gC++dl++ k+yh+rhkvCe+hsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Gh_A03G0632 176 CQVYGCNKDLTSSKDYHKRHKVCEAHSKTEKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 251
                  **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.2E-34169237IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.376173250IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.09E-38174253IPR004333Transcription factor, SBP-box
PfamPF031104.3E-32176249IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MESWSYVSGE NGSESDAANS ASDSFVRNRN AFMNLELKSP YSFSNNMIVS GQQTIESHGF  60
GELGYGELIG KQLTNGSIGD VLSSKVSEAR TENPILATLN TFSVDDESSS MLSSSVVDSN  120
SRDSLLIDLK LGRFPDYIDG QSSSLSIGAP ILSSCESSTP PKRVRAAGAN SHTAYCQVYG  180
CNKDLTSSKD YHKRHKVCEA HSKTEKVIVN GIEQRFCQQC SRFHLLAEFD DGKRSCRKRL  240
AGHNERRRKP QVGIRYGRTG RLLQPYNGFV SGRLQGTMLT NTSFICEDVR TSGLLHPEKY  300
VTNEWGKRIK VEDGTDFSPL SAIPVKNGGH FEKHFPYFHN GPSAVTGGIL GENNARYPHG  360
FDGTYSGSRP LFQGTSSSAS EDINVFDAAL SIQGLSGISD SVCALSLLSS QSHSSSSRSS  420
GIPMARSLVI PGYHNHHMTQ VSEKLDRVSN TISSSGINST EGGNMGAILI SDSSEAANFN  480
ITDGLSCKDG PTINLLQLSS QLQRVEHQRQ SMQEDNENET YLRIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-291762491184squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223140.0KJ622314.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012470847.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_012470849.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A0B0P0D00.0A0A0B0P0D0_G
STRINGVIT_17s0000g05020.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14770918
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.15e-49SBP family protein